PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0407s0033.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 422aa    MW: 44917.5 Da    PI: 6.8648
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0407s0033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like833.2e-26162215156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++WtpeLH+rFv+aveqLG  ekA+P++ile+m+ +gLt+++++SHLQkYR++
  Kalax.0407s0033.1.p 162 KVKVDWTPELHKRFVQAVEQLG--EKAVPSRILEIMGTDGLTRHNIASHLQKYRSH 215
                          5689*****************4..88****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.29159217IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-25160218IPR009057Homeodomain-like
SuperFamilySSF466896.27E-15161218IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-25162215IPR006447Myb domain, plants
PfamPF002493.0E-10165213IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MQMLVASSSS LRDTATKSDD NPETIESGMD EFSDCFSAGS LLDSIDFDEL FAGLDGDPDA  60
LPDLEILGDY SISGGTADDR GQSSDDGNDA VSGSASGSPF RSGSGLDAGS VCSPGEGVVD  120
KAGDMDVKKD GPEGHFGKVK KSAASAGKAG RSKARGSDGN RKVKVDWTPE LHKRFVQAVE  180
QLGEKAVPSR ILEIMGTDGL TRHNIASHLQ KYRSHRKHLI AREAEAASWN QRRHMYGGAR  240
GGGMGKRVAV SPWLLPTIGY PPAMSGPMHH HPTVRPLHVW GHPSGDPSQT STMWPKHILP  300
HQLRPPHLHP RPVWAPPHLP YGQSQGMPCY PPPPQRFMAP PVPGIPHHAM YKTDPRAAAA  360
GPATILHQPL DSSPSNESID AALEDVLAKP WLPLPIGLKA PAIDTVVGEL QRQGVPQIPP  420
S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132777.11e-115hypothetical protein PHAVU_011G124200g
TrEMBLV7AKX51e-115V7AKX5_PHAVU; Uncharacterized protein
STRINGGLYMA12G13430.11e-107(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.17e-59GBF's pro-rich region-interacting factor 1